Yinherb Supply 98% Pure Exenatida/Exenatide Acetate Peptide Powder for Sale CAS: 141732-76-5

About this Item
Details
Company Profile

Price

Min. Order Reference FOB Price

25 G US$200.00-250.00 / G

Sepcifications

  • Powder Yes
  • Customized Customized
  • Certification GMP, HSE, ISO 9001, USP, BP
  • Suitable for Elderly, Adult
  • State Solid
  • Purity >99%
  • Transport Package 1g/Vial
  • Specification 99%
  • Trademark Yinherb
  • Origin China
  • CAS 141732-76-5
  • MOQ 1g
  • Sample Free
  • Appearance White Fine Powder
  • Test Method HPLC, Hnmr, LC-Ms, UV, IR
  • Shelf Life 2 Years
  • Grade Pharmaceutical Grade
  • Function Anti-Depressant
  • Application Capsules, Tablets, Pills
  • Storage Keep It in Stored Desiccated Below -18° C
  • Delivery 7-10days by TNT, FedEx, EMS, DHL

Product Description

Yinherb Supply 98% pure Exenatida/Exenatide Acetate peptide powder for sale CAS: 141732-76-5 Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: ...

Learn More

Exenatide Peptide Price Comparison
Transaction Info
Price US $ 200.00-250.00/ G US $ 38/ Piece US $ 38/ Piece US $ 38/ Piece US $ 136/ kg
Min Order 25 G 1000 Pieces 1000 Pieces 1000 Pieces 1000 kg
Trade Terms - - - - -
Payment Terms L/C, T/T, D/P, Western Union, Paypal, Money Gram, Bitcoin T/T T/T T/T T/T
Quality Control
Product Certification GMP, HSE, ISO 9001, USP, BP GMP, ISO 9001, Brc/Halal GMP, ISO 9001, Brc/Halal GMP, ISO 9001, Brc/Halal GMP, ISO 9001, BRC
Management System Certification ISO 9001, ISO 14001, HSE, GMP, BSCI, HACCP - - - -
Trade Capacity
Export Markets North America, South America, Eastern Europe, Southeast Asia, Africa, Oceania, Mid East, Eastern Asia, Western Europe North America, South America North America, South America North America, South America North America, South America
Annual Export Revenue - - - - -
Business Model OEM, ODM, Own Brand, Others - - - -
Average Lead Time Off-season: within 15 Day(s)
Peak-season: within 15 Day(s)
- - - -
Product Attributes
Specification
Powder: Yes;
Customized: Customized;
Suitable for: Elderly, Adult;
State: Solid;
Purity: >99%;
CAS: 141732-76-5;
MOQ: 1g;
Sample: Free;
Appearance: White Fine Powder;
Test Method: HPLC, Hnmr, LC-Ms, UV, IR;
Shelf Life: 2 Years;
Grade: Pharmaceutical Grade;
Function: Anti-Depressant;
Application: Capsules, Tablets, Pills;
Storage: Keep It in Stored Desiccated Below -18° C;
Delivery: 7-10days by TNT, FedEx, EMS, DHL;
Powder: Yes;
Customized: Customized;
Suitable for: Elderly, Children, Adult;
State: Solid;
Purity: 90-98%;
CAS Number: 9064-67-9;
Color: White or off-White;
Appearance: White or off-White Powder;
Impurity: No Visible Impurity;
Smell: Odorless;
Storage Conditions: Dry and Cool;
MOQ: 100 Kgs;
Shelf Life: 2 Years;
Grade: Food Grade, Animal Feed;
Leading Time: 3 Weeks;
Source: Chicken Sternum, Avian Cartilage;
Solubility: 100% Water Soluble;
Function and Application: Used for Arthritis and Osteoporosis;
Powder: Yes;
Customized: Customized;
Suitable for: Elderly, Children, Adult;
State: Solid;
Purity: 90-98%;
CAS Number: 9064-67-9;
Color: White or off-White;
Appearance: White or off-White Powder;
Impurity: No Visible Impurity;
Smell: Odorless;
Storage Conditions: Dry and Cool;
MOQ: 100 Kgs;
Shelf Life: 2 Years;
Grade: Food Grade, Animal Feed;
Leading Time: 3 Weeks;
Source: Chicken Sternum, Avian Cartilage;
Solubility: 100% Water Soluble;
Function and Application: Used for Arthritis and Osteoporosis;
Powder: Yes;
Customized: Customized;
Suitable for: Elderly, Children, Adult;
State: Solid;
Purity: 90-98%;
CAS Number: 9064-67-9;
Color: White or off-White;
Appearance: White or off-White Powder;
Impurity: No Visible Impurity;
Smell: Odorless;
Storage Conditions: Dry and Cool;
MOQ: 100 Kgs;
Shelf Life: 2 Years;
Grade: Food Grade, Animal Feed;
Leading Time: 3 Weeks;
Source: Chicken Sternum, Avian Cartilage;
Solubility: 100% Water Soluble;
Function and Application: Used for Arthritis and Osteoporosis;
Powder: Yes;
Customized: Customized;
Suitable for: Elderly, Children, Adult;
State: Solid;
Purity: 99%;
CAS Number: 9041-08-1;
Color: White or off-White;
Appearance: White or off-White Powder;
MOQ: 50 Kgs;
Storage Condition: Dry and Cool;
Grade: Pharmaceutical, Injection or Medical Grade;
Shelf Life: 2 Years;
Molecular Formula: (C12h16ns2na3)20;
Leading Time: 3 Weeks;
Function and Usage: Anticoagulant;
Solubility: 100% Water Soluble;
Molecular Weight: 15K. Dalton;
Titer: 50miu, 100miu, 120miu, 140miu, 150miu, 180miu;
Mesh: 80 Mesh, 100 Mesh;
Supplier Name

Xi′an Yinherb Bio-Tech Co., Ltd.

China Supplier - Gold Member Audited Supplier

HAIYANG SANFENG BIOCHEMICAL CO., LTD.

China Supplier - Diamond Member Audited Supplier

HAIYANG SANFENG BIOCHEMICAL CO., LTD.

China Supplier - Diamond Member Audited Supplier

HAIYANG SANFENG BIOCHEMICAL CO., LTD.

China Supplier - Diamond Member Audited Supplier

HAIYANG SANFENG BIOCHEMICAL CO., LTD.

China Supplier - Diamond Member Audited Supplier